PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han002216
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family NAC
Protein Properties Length: 265aa    MW: 29926.3 Da    PI: 5.2576
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Han#S48348089PU_refUnigeneView CDS
PUT-169a-Helianthus_annuus-28963PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.5e-52371641128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv++yL++k+ gk++++ ++++e+d+yk+ePw+L   +++k++++ewyfFs+ d+ky +g+r nrat +gyWkatgkd+ v + k+e
  Han002216  37 LAPGFRFHPTDEELVMYYLRRKACGKPFRF-QAVTEIDVYKSEPWELAdfSSLKTRDQEWYFFSPVDRKYGNGSRLNRATGQGYWKATGKDRCVRH-KSE 134
                579*************************99.88**************85448889999*************************************9.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++g+kktLvf++grap+g++t+Wvmheyrl
  Han002216 135 TIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 164
                ****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-6234187IPR003441NAC domain
PROSITE profilePS5100557.67637187IPR003441NAC domain
PfamPF023652.2E-2839164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
XCISVADQKS TNMGQEIIAV ATPATAAAPP PPPPTSLAPG FRFHPTDEEL VMYYLRRKAC  60
GKPFRFQAVT EIDVYKSEPW ELADFSSLKT RDQEWYFFSP VDRKYGNGSR LNRATGQGYW  120
KATGKDRCVR HKSETIGMKK TLVFHSGRAP DGKRTNWVMH EYRLLDHELL RVGVTQDSFV  180
LCRIFQKSGL GPPNGDRYAP FLEEEWNDDA ALMVPGGEAE DDLTNGDETR PEGNDSVQEA  240
IPFVCKRERS EDRAFNSEPE LEPSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D9e-543118714168NAC domain-containing protein 19
3swp_C9e-543118714168NAC domain-containing protein 19
3swp_B9e-543118714168NAC domain-containing protein 19
3swp_A9e-543118714168NAC domain-containing protein 19
3swm_D9e-543118714168NAC domain-containing protein 19
3swm_C9e-543118714168NAC domain-containing protein 19
3swm_B9e-543118714168NAC domain-containing protein 19
3swm_A9e-543118714168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619467.11e-142PREDICTED: NAC domain-containing protein 78-like
RefseqXP_016432498.11e-142PREDICTED: NAC domain-containing protein 78-like
SwissprotQ84K003e-89NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A068TWS91e-142A0A068TWS9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797911e-136(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.16e-98NAC domain containing protein 52